PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G33060.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 264aa    MW: 27688.5 Da    PI: 9.5497
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G33060.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.34.4e-15182234355
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN ++ ke ee  ++
  LPERR01G33060.2 182 AMQRQKRMIKNRESAARSRERKQAYIAELESLVMQLEEENAKMFKEQEEQHQK 234
                      689*************************************9998877665444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.2E-9180244IPR004827Basic-leucine zipper domain
PfamPF001704.5E-14182241IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.783182246IPR004827Basic-leucine zipper domain
CDDcd147076.26E-21184234No hitNo description
SuperFamilySSF579591.76E-10184233No hitNo description
Gene3DG3DSA:1.20.5.1707.5E-13185242No hitNo description
PROSITE patternPS000360187202IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MASSRVMASS SPSHTTSDLA RFAAGRGGST GLGSMNVEEI LRGIYADMPT PSLAPVVDGG  60
RPMSPPPAPG IAAAAAAPRT AEEVWKEITG GVGVAAAAPD VVAAGGGGGA GGGAGAAEMT  120
LEDFLAREGG AVKEDVVAGP SASAVEGQVV MGFLNGAEVA GGVTGGGRSR KRQLMDPMDR  180
AAMQRQKRMI KNRESAARSR ERKQAYIAEL ESLVMQLEEE NAKMFKEQEE QHQKRLKELK  240
EMITPVVVRK MPSRDLRRTN SMQW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679191e-140AK067919.1 Oryza sativa Japonica Group cDNA clone:J013123H12, full insert sequence.
GenBankGQ9042381e-140GQ904238.1 Oryza sativa Japonica Group ABA responsive element binding factor 1 mRNA, complete cds.
GenBankOSU252831e-140U25283.1 Oryza sativa clone OSE2 leucine zipper protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612904.11e-113PREDICTED: G-box-binding factor 4
TrEMBLA0A0D9V8760.0A0A0D9V876_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9V8770.0A0A0D9V877_9ORYZ; Uncharacterized protein
STRINGBGIOSGA000430-PA1e-114(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.13e-29G-box binding factor 4